GEM (NM_005261) Human Mass Spec Standard
CAT#: PH323722
GEM MS Standard C13 and N15-labeled recombinant protein (NP_005252)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | GEM MS Standard C13 and N15-labeled recombinant protein (NP_005252) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223722 |
Predicted MW | 33.8 kDa |
Protein Sequence |
>RC223722 representing NM_005261
Red=Cloning site Green=Tags(s) MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSE SGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENE WLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACA VVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKN MAFKLKSKSCHDLSVL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005252 |
RefSeq Size | 2205 |
RefSeq ORF | 888 |
Synonyms | KIR |
Locus ID | 2669 |
Cytogenetics | 8q22.1 |
Summary | The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401618 | GEM HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405649 | GEM HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401618 | Transient overexpression lysate of GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1 |
CN¥ 3,080.00 |
|
LY405649 | Transient overexpression lysate of GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2 |
CN¥ 3,080.00 |
|
PH305286 | GEM MS Standard C13 and N15-labeled recombinant protein (NP_859053) |
CN¥ 19,520.00 |
|
TP305286 | Recombinant protein of human GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP323722 | Recombinant protein of human GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, 20 µg |
CN¥ 2,900.00 |