IFNA4 (NM_021068) Human Mass Spec Standard
CAT#: PH323649
IFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_066546)
View other "IFNA4" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | IFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_066546) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223649 |
Predicted MW | 21.8 kDa |
Protein Sequence |
>RC223649 protein sequence
Red=Cloning site Green=Tags(s) MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFGFPEEEFDGHQ FQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSI LAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066546 |
RefSeq Size | 982 |
RefSeq ORF | 567 |
Synonyms | IFN-alpha4a; INFA4 |
Locus ID | 3441 |
Cytogenetics | 9p21.3 |
Summary | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412102 | IFNA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY412102 | Transient overexpression lysate of interferon, alpha 4 (IFNA4) |
CN¥ 3,080.00 |
|
TP323649 | Recombinant protein of human interferon, alpha 4 (IFNA4), 20 µg |
CN¥ 2,900.00 |
|
TP721075 | Purified recombinant protein of Human interferon, alpha 4 (IFNA4) |
CN¥ 1,800.00 |