Haptoglobin (HP) (NM_005143) Human Mass Spec Standard
CAT#: PH323612
HP MS Standard C13 and N15-labeled recombinant protein (NP_005134)
View other "Haptoglobin" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | HP MS Standard C13 and N15-labeled recombinant protein (NP_005134) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223612 |
Predicted MW | 45.21 kDa |
Protein Sequence |
>RC223612 representing NM_005143
Red=Cloning site Green=Tags(s) MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLND KKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGD KLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSE NATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGY VSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDT CYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005134 |
RefSeq Size | 1433 |
RefSeq ORF | 1218 |
Synonyms | BP; HP2ALPHA2; HPA1S |
Locus ID | 3240 |
Cytogenetics | 16q22.2 |
Summary | This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin, which allows degradative enzymes to gain access to the hemoglobin, while at the same time preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin. Mutations in this gene and/or its regulatory regions cause ahaptoglobinemia or hypohaptoglobinemia. This gene has also been linked to diabetic nephropathy, the incidence of coronary artery disease in type 1 diabetes, Crohn's disease, inflammatory disease behavior, primary sclerosing cholangitis, susceptibility to idiopathic Parkinson's disease, and a reduced incidence of Plasmodium falciparum malaria. The protein encoded also exhibits antimicrobial activity against bacteria. A similar duplicated gene is located next to this gene on chromosome 16. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014] |
Protein Families | Druggable Genome, Protease, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401576 | HP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426644 | HP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401576 | Transient overexpression lysate of haptoglobin (HP), transcript variant 1 |
CNY 3,080.00 |
|
LY426644 | Transient overexpression lysate of haptoglobin (HP), transcript variant 2 |
CNY 3,080.00 |
|
TP323612 | Recombinant protein of human haptoglobin (HP), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP721131 | Purified recombinant protein of Human haptoglobin (HP), transcript variant 1 |
CNY 3,140.00 |
|
TP721202 | Purified recombinant protein of Human haptoglobin (HP), transcript variant 1 |
CNY 3,140.00 |
其它Haptoglobin产品