RSU1 (NM_152724) Human Mass Spec Standard
CAT#: PH323579
RSU1 MS Standard C13 and N15-labeled recombinant protein (NP_689937)
View other "RSU1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RSU1 MS Standard C13 and N15-labeled recombinant protein (NP_689937) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223579 |
Predicted MW | 31.5 kDa |
Protein Sequence |
>RC223579 protein sequence
Red=Cloning site Green=Tags(s) MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNF FNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALY LSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQV FKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_689937 |
RefSeq Size | 3657 |
RefSeq ORF | 834 |
Synonyms | RSP-1 |
Locus ID | 6251 |
Cytogenetics | 10p13 |
Summary | This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407344 | RSU1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407344 | Transient overexpression lysate of Ras suppressor protein 1 (RSU1), transcript variant 2 |
CNY 3,080.00 |
|
TP323579 | Recombinant protein of human Ras suppressor protein 1 (RSU1), transcript variant 2, 20 µg |
CNY 2,900.00 |