RAB27A (NM_183236) Human Mass Spec Standard
CAT#: PH323511
RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899059)
View other "RAB27A" proteins (16)
Need it in bulk or customized? Get a free quote |
CN¥ 14,250.00
Specifications
Product Data | |
Description | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899059) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223511 |
Predicted MW | 24.7 kDa |
Protein Sequence |
>RC223511 representing NM_183236
Red=Cloning site Green=Tags(s) MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ RVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQL SEEKEKGACGC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_899059 |
RefSeq Size | 2772 |
RefSeq ORF | 663 |
Synonyms | GS2; HsT18676; RAB27; RAM |
Locus ID | 5873 |
Cytogenetics | 15q21.3 |
Summary | The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405229 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405230 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405231 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC417890 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC430653 | RAB27A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY405229 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 2 |
CN¥ 3,080.00 |
|
LY405230 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 3 |
CN¥ 3,080.00 |
|
LY405231 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 4 |
CN¥ 3,080.00 |
|
LY417890 | Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 1 |
CN¥ 3,080.00 |
|
PH317900 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899057) |
CN¥ 19,520.00 |
|
PH319810 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899058) |
CN¥ 14,250.00 |
|
PH320897 | RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_004571) |
CN¥ 14,250.00 |
|
TP317900 | Recombinant protein of human RAB27A, member RAS oncogene family (RAB27A), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP319810 | Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP320897 | Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP323511 | Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 4, 20 µg |
CN¥ 2,900.00 |