United States
Germany
Japan
United Kingdom
China
TRAF4AF1 (KNSTRN) (NM_033286) Human Mass Spec Standard
CAT＃: PH322981
C15orf23 MS Standard C13 and N15-labeled recombinant protein (NP_150628)
View other "TRAF4AF1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | C15orf23 MS Standard C13 and N15-labeled recombinant protein (NP_150628) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222981 |
| Predicted MW | 35.4 kDa |
| Protein Sequence |
>RC222981 protein sequence
Red=Cloning site Green=Tags(s) MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQEADLAGGTTVAAGNLLNESEKDCGQDRRAPG VQPCLLVTMTSVVKTVYSLQPSSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITK LRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELL EKFRDNCLAILESKGLDPALGGETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQMEELQALKVKL EMKEERVRFLEQQTLCNNQVNDLTTALKEMEQLLEM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_150628 |
| RefSeq Size | 1763 |
| RefSeq ORF | 948 |
| Synonyms | C15orf23; HSD11; SKAP; TRAF4AF1 |
| Locus ID | 90417 |
| Cytogenetics | 15q15.1 |
| Summary | Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase (PubMed:19667759). Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture (PubMed:19667759, PubMed:22110139). The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments (PubMed:21402792). Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division (PubMed:23035123). May be involved in UV-induced apoptosis via its interaction with PRPF19; however, these results need additional evidences (PubMed:24718257).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409608 | KNSTRN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428260 | KNSTRN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428261 | KNSTRN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409608 | Transient overexpression lysate of chromosome 15 open reading frame 23 (C15orf23), transcript variant 1 |
CNY 3,080.00 |
|
| LY428260 | Transient overexpression lysate of chromosome 15 open reading frame 23 (C15orf23), transcript variant 2 |
CNY 3,080.00 |
|
| LY428261 | Transient overexpression lysate of chromosome 15 open reading frame 23 (C15orf23), transcript variant 3 |
CNY 3,080.00 |
|
| TP322981 | Recombinant protein of human chromosome 15 open reading frame 23 (C15orf23), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP701003 | Purified recombinant protein of Human chromosome 15 open reading frame 23 (C15orf23), transcript variant 3, mutant (S24F), expressed in HEK293 cells, 20ug |
CNY 6,650.00 |
其它TRAF4AF1产品
