TRAF4AF1 (KNSTRN) (NM_033286) Human Recombinant Protein

CAT#: TP322981M

Recombinant protein of human chromosome 15 open reading frame 23 (C15orf23), transcript variant 1, 100 µg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 9,998.00


货期*
4周

规格
    • 100 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Rabbit Polyclonal Anti-KNSTRN Antibody
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC222981 protein sequence
Red=Cloning site Green=Tags(s)

MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQEADLAGGTTVAAGNLLNESEKDCGQDRRAPG
VQPCLLVTMTSVVKTVYSLQPSSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITK
LRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELL
EKFRDNCLAILESKGLDPALGGETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQMEELQALKVKL
EMKEERVRFLEQQTLCNNQVNDLTTALKEMEQLLEM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_150628
Locus ID 90417
UniProt ID Q9Y448
Refseq Size 1763
Cytogenetics 15q15.1
Refseq ORF 948
Synonyms C15orf23; HSD11; SKAP; TRAF4AF1
Summary Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase (PubMed:19667759). Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture (PubMed:19667759, PubMed:22110139). The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments (PubMed:21402792). Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division (PubMed:23035123). May be involved in UV-induced apoptosis via its interaction with PRPF19; however, these results need additional evidences (PubMed:24718257).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...