United States
Germany
Japan
United Kingdom
China
HOPX (NM_139212) Human Mass Spec Standard
CAT＃: PH322903
HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631958)
View other "HOPX" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631958) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222903 |
| Predicted MW | 8.1 kDa |
| Protein Sequence |
>RC222903 representing NM_139212
Red=Cloning site Green=Tags(s) MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS VTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_631958 |
| RefSeq Size | 1116 |
| RefSeq ORF | 219 |
| Synonyms | CAMEO; HOD; HOP; LAGY; NECC1; OB1; SMAP31; TOTO |
| Locus ID | 84525 |
| Cytogenetics | 4q12 |
| Summary | The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Feb 2009] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408356 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408357 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410073 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428902 | HOPX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408356 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 2 |
CNY 3,080.00 |
|
| LY408357 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 3 |
CNY 3,080.00 |
|
| LY410073 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 1 |
CNY 3,080.00 |
|
| LY428902 | Transient overexpression lysate of HOP homeobox (HOPX), transcript variant 4 |
CNY 3,080.00 |
|
| PH304361 | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_631957) |
CNY 14,250.00 |
|
| PH322859 | HOPX MS Standard C13 and N15-labeled recombinant protein (NP_115884) |
CNY 19,520.00 |
|
| TP304361 | Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP322859 | Recombinant protein of human HOP homeobox (HOPX), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP322903 | Purified recombinant protein of Homo sapiens HOP homeobox (HOPX), transcript variant 3, 20 µg |
CNY 2,900.00 |
