MRPS33 (NM_053035) Human Mass Spec Standard
CAT#: PH322833
MRPS33 MS Standard C13 and N15-labeled recombinant protein (NP_444263)
View other "MRPS33" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MRPS33 MS Standard C13 and N15-labeled recombinant protein (NP_444263) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222833 |
Predicted MW | 12.4 kDa |
Protein Sequence |
>RC222833 representing NM_053035
Red=Cloning site Green=Tags(s) MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGL YRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_444263 |
RefSeq Size | 653 |
RefSeq ORF | 318 |
Synonyms | CGI-139; MRP-S33; PTD003; S33mt |
Locus ID | 51650 |
Cytogenetics | 7q34 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that is one of the more highly conserved mitochondrial ribosomal proteins among mammals, Drosophila and C. elegans. Splice variants that differ in the 5' UTR have been found for this gene; all variants encode the same protein. Pseudogenes corresponding to this gene are found on chromosomes 1q, 4p, 4q, and 20q [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409334 | MRPS33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414210 | MRPS33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409334 | Transient overexpression lysate of mitochondrial ribosomal protein S33 (MRPS33), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
LY414210 | Transient overexpression lysate of mitochondrial ribosomal protein S33 (MRPS33), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
TP322833 | Recombinant protein of human mitochondrial ribosomal protein S33 (MRPS33), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760023 | Recombinant protein of human mitochondrial ribosomal protein S33 (MRPS33), nuclear gene encoding mitochondrial protein, transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |