United States
Germany
Japan
United Kingdom
China
KRAS (NM_033360) Human Mass Spec Standard
CAT＃: PH322697
KRAS MS Standard C13 and N15-labeled recombinant protein (NP_203524)
View other "KRAS" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 3,080.00
Specifications
| Product Data | |
| Description | KRAS MS Standard C13 and N15-labeled recombinant protein (NP_203524) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222697 |
| Predicted MW | 21.5 kDa |
| Protein Sequence |
>RC222697 representing NM_033360
Red=Cloning site Green=Tags(s) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ YMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIP FIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_203524 |
| RefSeq Size | 5436 |
| RefSeq ORF | 567 |
| Synonyms | C-K-RAS; c-Ki-ras2; CFC2; K-Ras; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; KI-RAS; KRAS1; KRAS2; NS; NS3; RALD; RASK2 |
| Locus ID | 3845 |
| Cytogenetics | 12p12.1 |
| Summary | This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Acute myeloid leukemia, Axon guidance, B cell receptor signaling pathway, Bladder cancer, Chemokine signaling pathway, Chronic myeloid leukemia, Colorectal cancer, Dorso-ventral axis formation, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Thyroid cancer, Tight junction, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409579 | KRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417614 | KRAS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409579 | Transient overexpression lysate of v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant a |
CNY 3,080.00 |
|
| LY417614 | Transient overexpression lysate of v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant b |
CNY 3,080.00 |
|
| PH301958 | KRAS MS Standard C13 and N15-labeled recombinant protein (NP_004976) |
CNY 19,520.00 |
|
| TP301958 | Recombinant protein of human v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant b, 20 µg |
CNY 2,900.00 |
|
| TP322697 | Recombinant protein of human v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant a, 20 µg |
CNY 2,900.00 |
|
| TP700052 | KRAS mutant (G12D) Myc-DDK-tagged human recombinant protein of Homo sapiens v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant b |
CNY 6,650.00 |
