PON2 (NM_000305) Human Mass Spec Standard
CAT#: PH322624
PON2 MS Standard C13 and N15-labeled recombinant protein (NP_000296)
View other "PON2" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | PON2 MS Standard C13 and N15-labeled recombinant protein (NP_000296) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222624 |
Predicted MW | 39.2 kDa |
Protein Sequence |
>RC222624 representing NM_000305
Red=Cloning site Green=Tags(s) MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDIDILPNGLAFFSVGLK FPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTV EIFKFEEAENSLLHLKTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPN EVKVVAEGFDSANGINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW VGCHPNGQKLFVYDPNNPPSSEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVYDGKLLIGTLYHRAL YCEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000296 |
RefSeq Size | 1669 |
RefSeq ORF | 1062 |
Locus ID | 5445 |
Cytogenetics | 7q21.3 |
Summary | This gene encodes a member of the paraoxonase gene family, which includes three known members located adjacent to each other on the long arm of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded protein may also play a role in defense responses to pathogenic bacteria. Mutations in this gene may be associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400116 | PON2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC422669 | PON2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400116 | Transient overexpression lysate of paraoxonase 2 (PON2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY422669 | Transient overexpression lysate of paraoxonase 2 (PON2), transcript variant 2 |
CN¥ 3,080.00 |
|
TP322624 | Recombinant protein of human paraoxonase 2 (PON2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |