ANKS1B (NM_020140) Human Mass Spec Standard
CAT#: PH322572
ANKS1B MS Standard C13 and N15-labeled recombinant protein (NP_064525)
View other "ANKS1B" proteins (7)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ANKS1B MS Standard C13 and N15-labeled recombinant protein (NP_064525) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222572 |
Predicted MW | 46.9 kDa |
Protein Sequence |
>RC222572 representing NM_020140
Red=Cloning site Green=Tags(s) MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTGPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQFMGS NVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGDYTKAFLINGYTSMD LLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLRTGDWGEPSITLRPPNEATASTP VQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGV KFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEV AYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVDLLHASHTGQEPSERHTEEALRKF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_064525 |
RefSeq Size | 1714 |
RefSeq ORF | 1242 |
Synonyms | AIDA; AIDA-1; ANKS2; cajalin-2; EB-1; EB1 |
Locus ID | 56899 |
Cytogenetics | 12q23.1 |
Summary | This gene encodes a multi-domain protein that is predominantly expressed in brain and testis. This protein interacts with amyloid beta protein precursor (AbetaPP) and may have a role in normal brain development, and in the pathogenesis of Alzheimer's disease. Expression of this gene has been shown to be elevated in patients with pre-B cell acute lymphocytic leukemia associated with t(1;19) translocation. Alternatively spliced transcript variants encoding different isoforms (some with different subcellular localization, PMID:15004329) have been described for this gene. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405556 | ANKS1B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC407279 | ANKS1B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC412629 | ANKS1B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY405556 | Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 2 |
CN¥ 4,840.00 |
|
LY407279 | Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 1 |
CN¥ 4,840.00 |
|
LY412629 | Transient overexpression lysate of ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 3 |
CN¥ 3,080.00 |
|
TP322572 | Recombinant protein of human ankyrin repeat and sterile alpha motif domain containing 1B (ANKS1B), transcript variant 3, 20 µg |
CN¥ 2,900.00 |