Myelin oligodendrocyte glycoprotein (MOG) (NM_206809) Human Mass Spec Standard
CAT#: PH322455
MOG MS Standard C13 and N15-labeled recombinant protein (NP_996532)
View other "Myelin oligodendrocyte glycoprotein" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MOG MS Standard C13 and N15-labeled recombinant protein (NP_996532) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222455 |
Predicted MW | 25.1 kDa |
Protein Sequence |
>RC222455 representing NM_206809
Red=Cloning site Green=Tags(s) MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYR PPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAM ELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKIT LFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_996532 |
RefSeq Size | 2119 |
RefSeq ORF | 741 |
Synonyms | BTN6; BTNL11; MOGIG2; NRCLP7 |
Locus ID | 4340 |
Cytogenetics | 6p22.1 |
Summary | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404218 | MOG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404218 | Transient overexpression lysate of myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1 |
CNY 3,080.00 |
|
TP322455 | Recombinant protein of human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1, 20 µg |
CNY 2,900.00 |
|
TP701232 | Purified recombinant protein of Human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha1, Gly30-Val155, with C-terminal His tag, expressed in HEK293 cells, 50ug |
CNY 7,820.00 |
|
TP720042 | Recombinant protein of human myelin oligodendrocyte glycoprotein (MOG), transcript variant alpha3 |
CNY 3,140.00 |
|
TP724034 | Recombinant Human Myelin Oligodendrocyte Glycoprotein/MOG (C-His) |
CNY 3,140.00 |
其它Myelin oligodendrocyte glycoprotein产品