CHKL (CHKB) (NM_152253) Human Mass Spec Standard
CAT#: PH322406
CHKB MS Standard C13 and N15-labeled recombinant protein (NP_689466)
View other "CHKL" proteins (9)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | CHKB MS Standard C13 and N15-labeled recombinant protein (NP_689466) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222406 |
Predicted MW | 13.3 kDa |
Protein Sequence |
>RC222406 representing NM_152253
Red=Cloning site Green=Tags(s) MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR VYPVRWEVRGQPLRCADRGQGSAAGPSGCSMFSPPSCARAWGGAGPAWPGGGRGRGR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_689466 |
RefSeq Size | 4914 |
RefSeq ORF | 381 |
Synonyms | CHETK; CHKL; choline/ethanolamine kinase; choline kinase-like; choline kinase beta; CKEKB; EKB |
Locus ID | 1120 |
Cytogenetics | 22q13.33 |
Summary | Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. [provided by RefSeq, Jun 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407681 | CHKB HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC417454 | CHKB HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC429244 | CHKB HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY407681 | Transient overexpression lysate of choline kinase beta (CHKB), transcript variant 2 |
CN¥ 3,080.00 |
|
LY417454 | Transient overexpression lysate of choline kinase beta (CHKB) |
CN¥ 3,080.00 |
|
LY429244 | Transient overexpression lysate of choline kinase beta (CHKB) |
CN¥ 3,080.00 |
|
PH310253 | CHKB MS Standard C13 and N15-labeled recombinant protein (NP_005189) |
CN¥ 19,520.00 |
|
TP310253 | Recombinant protein of human choline kinase beta (CHKB), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP322406 | Recombinant protein of human choline kinase beta (CHKB), transcript variant 2, 20 µg |
CN¥ 2,900.00 |