SHARPIN (NM_030974) Human Mass Spec Standard
CAT#: PH322012
SHARPIN MS Standard C13 and N15-labeled recombinant protein (NP_112236)
View other "SHARPIN" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SHARPIN MS Standard C13 and N15-labeled recombinant protein (NP_112236) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222012 |
Predicted MW | 39.8 kDa |
Protein Sequence |
>RC222012 representing NM_030974
Red=Cloning site Green=Tags(s) MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNL EWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEAC PVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQ EACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPE RSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQP SWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112236 |
RefSeq Size | 1765 |
RefSeq ORF | 1161 |
Synonyms | SIPL1 |
Locus ID | 81858 |
Cytogenetics | 8q24.3 |
Summary | Component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Together with OTULIN, the LUBAC complex regulates the canonical Wnt signaling during angiogenesis.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410637 | SHARPIN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410637 | Transient overexpression lysate of SHANK-associated RH domain interactor (SHARPIN) |
CNY 3,080.00 |
|
TP322012 | Recombinant protein of human SHANK-associated RH domain interactor (SHARPIN), 20 µg |
CNY 2,900.00 |
其它SHARPIN产品