RAP1B (NM_001010942) Human Mass Spec Standard
CAT#: PH321793
RAP1B MS Standard C13 and N15-labeled recombinant protein (NP_001010942)
View other "RAP1B" proteins (6)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | RAP1B MS Standard C13 and N15-labeled recombinant protein (NP_001010942) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221793 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC221793 representing NM_001010942
Red=Cloning site Green=Tags(s) MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDL YMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNN CAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001010942 |
RefSeq Size | 2117 |
RefSeq ORF | 552 |
Synonyms | K-REV; RAL1B |
Locus ID | 5908 |
Cytogenetics | 12q15 |
Summary | This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. This protein also plays a role in regulating outside-in signaling in platelets. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 5, 6 and 9. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway, Focal adhesion, Leukocyte transendothelial migration, Long-term potentiation, MAPK signaling pathway, Neurotrophin signaling pathway, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402456 | RAP1B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC423244 | RAP1B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402456 | Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1 |
CN¥ 3,080.00 |
|
LY423244 | Transient overexpression lysate of RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2 |
CN¥ 3,080.00 |
|
TP321793 | Recombinant protein of human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP760456 | Purified recombinant protein of Human RAP1B, member of RAS oncogene family (RAP1B), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |