United States
Germany
Japan
United Kingdom
China
OSBPL9 (NM_148907) Human Mass Spec Standard
CAT＃: PH321526
OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683705)
View other "OSBPL9" proteins (19)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683705) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221526 |
| Predicted MW | 70.1 kDa |
| Protein Sequence |
>RC221526 representing NM_148907
Red=Cloning site Green=Tags(s) MAFLLATCGGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKLFDDKLQNCKEDEQRKKIETLKETTNSMV ESIKHCIVLLQIAKSTINPVDAIYQPSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLPVGPVLATLGH HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSASV LTHSSSGNSLKRPDTTESLNSSLSNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMHLLSQVRLGMDLTK VVLPTFILERRSLLEMYADFFAHPDLFVSISDQKDPKDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGE IFQCHWTLPNDTEENTELVSEGPVPWVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSKFL GMSIGVHNIGQGCVSCLDYDEHYILTFPNGYGRSILTVPWVELGGECNINCSKTGYSANIIFHTKPFYGG KKHRITAEIFSPNDKKSFCSIEGEWNGVMYAKYATGENTVFVDTKKLPIIKKKVRKLEDQNEYESRSLWK DVTFNLKIRDIDAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_683705 |
| RefSeq Size | 2694 |
| RefSeq ORF | 1878 |
| Synonyms | ORP-9; ORP9 |
| Locus ID | 114883 |
| Cytogenetics | 1p32.3 |
| Summary | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. This family member functions as a cholesterol transfer protein that regulates Golgi structure and function. Multiple transcript variants, most of which encode distinct isoforms, have been identified. Related pseudogenes have been identified on chromosomes 3, 11 and 12. [provided by RefSeq, Jul 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407760 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407761 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC407762 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC407763 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC407764 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC407765 | OSBPL9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY407760 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 1 |
CNY 3,080.00 |
|
| LY407761 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 2 |
CNY 4,840.00 |
|
| LY407762 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 3 |
CNY 4,840.00 |
|
| LY407763 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 4 |
CNY 4,840.00 |
|
| LY407764 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 5 |
CNY 4,840.00 |
|
| LY407765 | Transient overexpression lysate of oxysterol binding protein-like 9 (OSBPL9), transcript variant 7 |
CNY 4,840.00 |
|
| PH311520 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683707) |
CNY 19,520.00 |
|
| PH321053 | OSBPL9 MS Standard C13 and N15-labeled recombinant protein (NP_683706) |
CNY 19,520.00 |
|
| TP311520 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 7, 20 µg |
CNY 2,900.00 |
|
| TP321053 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP321526 | Recombinant protein of human oxysterol binding protein-like 9 (OSBPL9), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP760439 | Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
| TP760538 | Purified recombinant protein of Human oxysterol binding protein-like 9 (OSBPL9), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
