PANK1 (NM_138316) Human Mass Spec Standard
CAT#: PH321519
PANK1 MS Standard C13 and N15-labeled recombinant protein (NP_612189)
View other "PANK1" proteins (9)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | PANK1 MS Standard C13 and N15-labeled recombinant protein (NP_612189) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221519 |
Predicted MW | 35.4 kDa |
Protein Sequence |
>RC221519 representing NM_138316
Red=Cloning site Green=Tags(s) MKLINGKKQTFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGKTGIRDVHLEL KNLTMCGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELD CLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTG TSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMD FWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612189 |
RefSeq Size | 2525 |
RefSeq ORF | 942 |
Synonyms | PANK |
Locus ID | 53354 |
Cytogenetics | 10q23.31 |
Summary | This gene encodes a member of the pantothenate kinase family. Pantothenate kinases are key regulatory enzymes in the biosynthesis of coenzyme A (CoA). The encoded protein catalyzes the first and rate-limiting enzymatic reaction in CoA biosynthesis and is regulated by CoA through feedback inhibition. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. This gene and an intronic miRNA on the same strand are co-regulated by the tumor suppressor p53 (see PMID 20833636). [provided by RefSeq, Apr 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407715 | PANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC407716 | PANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC408718 | PANK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY407715 | Transient overexpression lysate of pantothenate kinase 1 (PANK1), transcript variant alpha |
CN¥ 4,840.00 |
|
LY407716 | Transient overexpression lysate of pantothenate kinase 1 (PANK1), transcript variant beta |
CN¥ 3,080.00 |
|
LY408718 | Transient overexpression lysate of pantothenate kinase 1 (PANK1), transcript variant gamma |
CN¥ 3,080.00 |
|
PH321538 | PANK1 MS Standard C13 and N15-labeled recombinant protein (NP_683878) |
CN¥ 14,250.00 |
|
TP321519 | Recombinant protein of human pantothenate kinase 1 (PANK1), transcript variant gamma, 20 µg |
CN¥ 2,900.00 |
|
TP321538 | Recombinant protein of human pantothenate kinase 1 (PANK1), transcript variant alpha, 20 µg |
CN¥ 2,900.00 |