ZFAND5 (NM_001102420) Human Mass Spec Standard
CAT#: PH321072
ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095890)
View other "ZFAND5" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095890) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221072 |
Predicted MW | 23.1 kDa |
Protein Sequence |
>RC221072 protein sequence
Red=Cloning site Green=Tags(s) MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRAD TSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSE EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKI QRI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001095890 |
RefSeq Size | 5887 |
RefSeq ORF | 639 |
Synonyms | ZA20D2; ZFAND5A; ZNF216 |
Locus ID | 7763 |
Cytogenetics | 9q21.13 |
Summary | Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416931 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420147 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420148 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416931 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c |
CNY 3,080.00 |
|
LY420147 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a |
CNY 3,080.00 |
|
LY420148 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b |
CNY 3,080.00 |
|
PH309943 | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_005998) |
CNY 19,520.00 |
|
PH321129 | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095891) |
CNY 19,520.00 |
|
TP309943 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, 20 µg |
CNY 2,900.00 |
|
TP321072 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a, 20 µg |
CNY 2,900.00 |
|
TP321129 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b, 20 µg |
CNY 2,900.00 |
|
TP710147 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |