SRA1 (NM_001035235) Human Mass Spec Standard
CAT#: PH320899
SRA1 MS Standard C13 and N15-labeled recombinant protein (NP_001030312)
View other "SRA1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SRA1 MS Standard C13 and N15-labeled recombinant protein (NP_001030312) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220899 |
Predicted MW | 25.5 kDa |
Protein Sequence |
>RC220899 representing NM_001035235
Red=Cloning site Green=Tags(s) MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSP GPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRR LALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFS EEAANEEKSAATAEKNHTIPGFQQAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001030312 |
RefSeq Size | 1534 |
RefSeq ORF | 1991 |
Synonyms | pp7684; SRA; SRAP; STRAA1 |
Locus ID | 10011 |
Cytogenetics | 5q31.3 |
Summary | Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA. [provided by RefSeq, Mar 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422126 | SRA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422126 | Transient overexpression lysate of steroid receptor RNA activator 1 (SRA1) |
CNY 3,080.00 |
|
TP320899 | Recombinant protein of human steroid receptor RNA activator 1 (SRA1), 20 µg |
CNY 2,900.00 |