RIPPLY2 (NM_001009994) Human Mass Spec Standard
CAT#: PH320725
RIPPLY2 MS Standard C13 and N15-labeled recombinant protein (NP_001009994)
View other "RIPPLY2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RIPPLY2 MS Standard C13 and N15-labeled recombinant protein (NP_001009994) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220725 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC220725 protein sequence
Red=Cloning site Green=Tags(s) MENAGGAEGTESGAAACAATDGPTRRAGADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASG KLYQFRHPVRLFWPKSKCYDYLYQEAEALLKNFPIQATISFYEDSDSEDEIEDLTCEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001009994 |
RefSeq Size | 674 |
RefSeq ORF | 384 |
Synonyms | C6orf159; dJ237I15.1; SCDO6 |
Locus ID | 134701 |
Cytogenetics | 6q14.2 |
Summary | This gene encodes a nuclear protein that belongs to a novel family of proteins required for vertebrate somitogenesis. Members of this family have a tetrapeptide WRPW motif that is required for interaction with the transcriptional repressor Groucho and a carboxy-terminal Ripply homology domain/Bowline-DSCR-Ledgerline conserved region required for transcriptional repression. Null mutant mice die soon after birth and display defects in axial skeleton segmentation due to defective somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423172 | RIPPLY2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423172 | Transient overexpression lysate of ripply2 homolog (zebrafish) (RIPPLY2) |
CNY 3,080.00 |
|
TP320725 | Recombinant protein of human ripply2 homolog (zebrafish) (RIPPLY2), 20 µg |
CNY 2,900.00 |
其它RIPPLY2产品