SNRPB (NM_198216) Human Mass Spec Standard
CAT#: PH320701
SNRPB MS Standard C13 and N15-labeled recombinant protein (NP_937859)
View other "SNRPB" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SNRPB MS Standard C13 and N15-labeled recombinant protein (NP_937859) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220701 |
Predicted MW | 24.4 kDa |
Protein Sequence |
>RC220701 representing NM_198216
Red=Cloning site Green=Tags(s) MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLV LLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQ VMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRG TPMGMPPPGMRPPPPGMRGPPPPGMRPPRP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_937859 |
RefSeq Size | 1007 |
RefSeq ORF | 720 |
Synonyms | CCMS; COD; Sm-B/B'; SmB/B'; SmB/SmB'; snRNP-B; SNRPB1 |
Locus ID | 6628 |
Cytogenetics | 20p13 |
Summary | The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome, Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404878 | SNRPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418902 | SNRPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404878 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1 |
CNY 3,080.00 |
|
LY418902 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2 |
CNY 3,080.00 |
|
TP320701 | Recombinant protein of human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP761620 | Purified recombinant protein of Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |