HP1 gamma (CBX3) (NM_016587) Human Mass Spec Standard
CAT#: PH320388
CBX3 MS Standard C13 and N15-labeled recombinant protein (NP_057671)
View other "HP1 gamma" proteins (6)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | CBX3 MS Standard C13 and N15-labeled recombinant protein (NP_057671) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220388 |
Predicted MW | 20.8 kDa |
Protein Sequence |
>RC220388 protein sequence
Red=Cloning site Green=Tags(s) MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCP ELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLM KWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057671 |
RefSeq Size | 2102 |
RefSeq ORF | 549 |
Synonyms | HECH; HP1-GAMMA; HP1Hs-gamma |
Locus ID | 11335 |
Cytogenetics | 7p15.2 |
Summary | At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. This protein binds histone H3 tails methylated at Lys-9 sites. This protein is also recruited to sites of ultraviolet-induced DNA damage and double-strand breaks. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene.[provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413887 | CBX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC416061 | CBX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY413887 | Transient overexpression lysate of chromobox homolog 3 (HP1 gamma homolog, Drosophila) (CBX3), transcript variant 2 |
CN¥ 3,080.00 |
|
LY416061 | Transient overexpression lysate of chromobox homolog 3 (HP1 gamma homolog, Drosophila) (CBX3), transcript variant 1 |
CN¥ 3,080.00 |
|
TP320388 | Recombinant protein of human chromobox homolog 3 (HP1 gamma homolog, Drosophila) (CBX3), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP760281 | Recombinant protein of human chromobox homolog 3 (CBX3), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |
其它HP1 gamma产品