ALDOB (NM_000035) Human Mass Spec Standard
CAT#: PH320062
ALDOB MS Standard C13 and N15-labeled recombinant protein (NP_000026)
View other "ALDOB" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ALDOB MS Standard C13 and N15-labeled recombinant protein (NP_000026) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220062 |
Predicted MW | 39.3 kDa |
Protein Sequence |
>RC220062 representing NM_000035
Red=Cloning site Green=Tags(s) MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSI NQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKK DGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVL AAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDA TLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSG AASTQSLFTACYTY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000026 |
RefSeq Size | 1669 |
RefSeq ORF | 1092 |
Synonyms | ALDB; ALDO2 |
Locus ID | 229 |
Cytogenetics | 9q31.1 |
Summary | Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance. [provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400007 | ALDOB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400007 | Transient overexpression lysate of aldolase B, fructose-bisphosphate (ALDOB) |
CNY 3,080.00 |
|
TP320062 | Recombinant protein of human aldolase B, fructose-bisphosphate (ALDOB), 20 µg |
CNY 2,900.00 |
|
TP760654 | Purified recombinant protein of human aldolase B, fructose-bisphosphate (ALDOB), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |