United States
Germany
Japan
United Kingdom
China
RBMS3 (NM_014483) Human Mass Spec Standard
CAT＃: PH320037
RBMS3 MS Standard C13 and N15-labeled recombinant protein (NP_055298)
View other "RBMS3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
| Product Data | |
| Description | RBMS3 MS Standard C13 and N15-labeled recombinant protein (NP_055298) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220037 |
| Predicted MW | 45.6 kDa |
| Protein Sequence |
>RC220037 representing NM_014483
Red=Cloning site Green=Tags(s) MGKRLDQPQMYPQYTYYYPHYLQTKQSYAPAPHPMAPPSPSTNSSSNNSSNNSSGEQLSKTNLYIRGLPP GTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPT NLYISNLPISMDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPG IPAPSEPLLCKFADGGQKKRQNQSKYTQNGRPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQ TSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGT YMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055298 |
| RefSeq Size | 1600 |
| RefSeq ORF | 1260 |
| Locus ID | 27303 |
| Cytogenetics | 3p24.1 |
| Summary | This gene encodes an RNA-binding protein that belongs to the c-myc gene single-strand binding protein family. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415242 | RBMS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424007 | RBMS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424008 | RBMS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC433053 | RBMS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415242 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein (RBMS3), transcript variant 2 |
CNY 4,840.00 |
|
| LY424007 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein (RBMS3), transcript variant 3 |
CNY 4,840.00 |
|
| LY424008 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein (RBMS3), transcript variant 1 |
CNY 4,840.00 |
|
| LY433053 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein 3 (RBMS3), transcript variant 5 |
CNY 3,080.00 |
|
| TP320037 | Purified recombinant protein of Homo sapiens RNA binding motif, single stranded interacting protein (RBMS3), transcript variant 2, 20 µg |
CNY 2,900.00 |
