ATP1B2 (NM_001678) Human Mass Spec Standard
CAT#: PH320004
ATP1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001669)
View other "ATP1B2" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ATP1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001669) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220004 |
Predicted MW | 33.4 kDa |
Protein Sequence |
>RC220004 protein sequence
Red=Cloning site Green=Tags(s) MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHT PKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDN GVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAEN LGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGR VAFKLRINKT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001669 |
RefSeq Size | 3350 |
RefSeq ORF | 870 |
Synonyms | AMOG |
Locus ID | 482 |
Cytogenetics | 17p13.1 |
Summary | The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014] |
Protein Families | Transmembrane |
Protein Pathways | Cardiac muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419811 | ATP1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419811 | Transient overexpression lysate of ATPase, Na+/K+ transporting, beta 2 polypeptide (ATP1B2) |
CN¥ 3,080.00 |
|
TP320004 | Recombinant protein of human ATPase, Na+/K+ transporting, beta 2 polypeptide (ATP1B2), 20 µg |
CN¥ 2,900.00 |