DYNLL1 (NM_001037494) Human Mass Spec Standard
CAT#: PH319822
DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032583)
View other "DYNLL1" proteins (12)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032583) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219822 |
Predicted MW | 10.2 kDa |
Protein Sequence |
>RC219822 representing NM_001037494
Red=Cloning site Green=Tags(s) MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET KHFIYFYLGQVAILLFKSG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001032583 |
RefSeq Size | 820 |
RefSeq ORF | 267 |
Synonyms | DLC1; DLC8; DNCL1; DNCLC1; hdlc1; LC8; LC8a; PIN |
Locus ID | 8655 |
Cytogenetics | 12q24.31 |
Summary | Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418456 | DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC421911 | DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC421912 | DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY418456 | Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3 |
CN¥ 3,080.00 |
|
LY421911 | Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY421912 | Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2 |
CN¥ 3,080.00 |
|
PH318700 | DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032584) |
CN¥ 19,520.00 |
|
PH318752 | DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_003737) |
CN¥ 19,520.00 |
|
TP318700 | Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP318752 | Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP319822 | Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP720193 | Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1 |
CN¥ 1,800.00 |