Vitamin D Receptor (VDR) (NM_001017535) Human Mass Spec Standard
CAT#: PH319628
VDR MS Standard C13 and N15-labeled recombinant protein (NP_001017535)
View other "Vitamin D Receptor" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | VDR MS Standard C13 and N15-labeled recombinant protein (NP_001017535) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219628 |
Predicted MW | 48.1 kDa |
Protein Sequence |
>RC219628 representing NM_001017535
Red=Cloning site Green=Tags(s) MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITK DNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHH KTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEE DSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFT MDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAA LIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE VFGNEIS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001017535 |
RefSeq Size | 4791 |
RefSeq ORF | 1281 |
Synonyms | NR1I1; PPP1R163 |
Locus ID | 7421 |
Cytogenetics | 12q13.11 |
Summary | This gene encodes vitamin D3 receptor, which is a member of the nuclear hormone receptor superfamily of ligand-inducible transcription factors. This receptor also functions as a receptor for the secondary bile acid, lithocholic acid. Downstream targets of vitamin D3 receptor are principally involved in mineral metabolism, though this receptor regulates a variety of other metabolic pathways, such as those involved in immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Jun 2018] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422745 | VDR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424760 | VDR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422745 | Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2 |
CNY 4,840.00 |
|
LY424760 | Transient overexpression lysate of vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1 |
CNY 3,080.00 |
|
PH309262 | VDR MS Standard C13 and N15-labeled recombinant protein (NP_000367) |
CNY 19,520.00 |
|
TP309262 | Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP319628 | Recombinant protein of human vitamin D (1,25- dihydroxyvitamin D3) receptor (VDR), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Vitamin D Receptor产品