CD272 (BTLA) (NM_181780) Human Mass Spec Standard
CAT#: PH319458
BTLA MS Standard C13 and N15-labeled recombinant protein (NP_861445)
View other "CD272" proteins (10)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | BTLA MS Standard C13 and N15-labeled recombinant protein (NP_861445) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219458 |
Predicted MW | 32.6 kDa |
Protein Sequence |
>RC219458 representing NM_181780
Red=Cloning site Green=Tags(s) MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS ERPSKDEMASRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPT EYASICVRS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_861445 |
RefSeq Size | 1239 |
RefSeq ORF | 867 |
Synonyms | BTLA1; CD272 |
Locus ID | 151888 |
Cytogenetics | 3q13.2 |
Summary | This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403628 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC421272 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC425974 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403628 | Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 1 |
CN¥ 3,080.00 |
|
LY421272 | Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 2 |
CN¥ 3,080.00 |
|
TP319458 | Recombinant protein of human B and T lymphocyte associated (BTLA), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP700213 | Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells |
CN¥ 6,650.00 |
|
TP700215 | Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells |
CN¥ 6,650.00 |
|
TP720688 | Purified recombinant protein of Human B and T lymphocyte associated (BTLA), transcript variant 1 |
CN¥ 1,800.00 |
|
TP723966 | Human BTLA Protein, mFc-His Tag |
CN¥ 5,249.00 |