MT1E (NM_175617) Human Mass Spec Standard
CAT#: PH319414
MT1E MS Standard C13 and N15-labeled recombinant protein (NP_783316)
View other "MT1E" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | MT1E MS Standard C13 and N15-labeled recombinant protein (NP_783316) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219414 |
Predicted MW | 6 kDa |
Protein Sequence |
>RC219414 protein sequence
Red=Cloning site Green=Tags(s) MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_783316 |
RefSeq Size | 519 |
RefSeq ORF | 183 |
Synonyms | MT-1E; MT-IE; MT1; MTD |
Locus ID | 4493 |
Cytogenetics | 16q13 |
Summary | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406270 | MT1E HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY406270 | Transient overexpression lysate of metallothionein 1E (MT1E) |
CN¥ 3,080.00 |
|
TP319414 | Recombinant protein of human metallothionein 1E (MT1E), 20 µg |
CN¥ 2,900.00 |