TIA1 (NM_022173) Human Mass Spec Standard
CAT#: PH319386
TIA1 MS Standard C13 and N15-labeled recombinant protein (NP_071505)
View other "TIA1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TIA1 MS Standard C13 and N15-labeled recombinant protein (NP_071505) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219386 |
Predicted MW | 42.8 kDa |
Protein Sequence |
>RC219386 representing NM_022173
Red=Cloning site Green=Tags(s) MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRK IMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKD MATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSS PSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVK CYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSS APWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_071505 |
RefSeq Size | 2390 |
RefSeq ORF | 1158 |
Synonyms | ALS26; TIA-1; WDM |
Locus ID | 7072 |
Cytogenetics | 2p13.3 |
Summary | The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms has been found for this gene. [provided by RefSeq, May 2017] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411728 | TIA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411728 | Transient overexpression lysate of TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2 |
CNY 3,080.00 |
|
TP319386 | Recombinant protein of human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP762405 | Purified recombinant protein of Human TIA1 cytotoxic granule-associated RNA binding protein (TIA1), transcript variant 2, Val279-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |