United States
Germany
Japan
United Kingdom
China
ENO3 (NM_001976) Human Mass Spec Standard
CAT＃: PH319257
ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_001967)
View other "ENO3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_001967) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219257 |
| Predicted MW | 46.8 kDa |
| Protein Sequence |
>RC219257 representing NM_001976
Red=Cloning site Green=Tags(s) MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN NTLGPALLQKKLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGN PDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKYGKDATNVGDE GGFAPNILENNEALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSV TESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK AIFAGRKFRNPKAK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001967 |
| RefSeq Size | 1494 |
| RefSeq ORF | 1302 |
| Synonyms | GSD13; MSE |
| Locus ID | 2027 |
| Cytogenetics | 17p13.2 |
| Summary | This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Jul 2010] |
| Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409322 | ENO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419609 | ENO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434201 | ENO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409322 | Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 2 |
CNY 3,080.00 |
|
| LY419609 | Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 1 |
CNY 3,080.00 |
|
| LY434201 | Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 3 |
CNY 3,080.00 |
|
| PH305684 | ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_443739) |
CNY 14,250.00 |
|
| TP305684 | Recombinant protein of human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP319257 | Recombinant protein of human enolase 3 (beta, muscle) (ENO3), transcript variant 1, 20 µg |
CNY 2,900.00 |
