ASZ1 (NM_130768) Human Mass Spec Standard
CAT#: PH319070
ASZ1 MS Standard C13 and N15-labeled recombinant protein (NP_570124)
View other "ASZ1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ASZ1 MS Standard C13 and N15-labeled recombinant protein (NP_570124) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219070 |
Predicted MW | 53.5 kDa |
Protein Sequence |
>RC219070 protein sequence
Red=Cloning site Green=Tags(s) MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKRLLPIEEKKEKFKKAMTIGDVSLVQELLDSGI SVDSNFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACSAHGSEEQILKCVELLLSRNA DPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKML QTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLE VFLHGLGLEHMTDLLKERDITLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLE ISGDEFLNFLLKLNKQCGHLITAVQNVITELPVNSQKITLEWASPQNFTSVCEELVNNVEDLSEKVCKLK DLIQKLQNERENDPTHIQLREEVSTWNSRILKRTAITICGFGFLLFICKLTFQRK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_570124 |
RefSeq Size | 1865 |
RefSeq ORF | 1425 |
Synonyms | ALP1; ANKL1; C7orf7; CT1.19; GASZ; Orf3 |
Locus ID | 136991 |
Cytogenetics | 7q31.2 |
Summary | Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process. Required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in the regulation of retrotransposons. May act by mediating protein-protein interactions during germ cell maturation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408931 | ASZ1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY408931 | Transient overexpression lysate of ankyrin repeat, SAM and basic leucine zipper domain containing 1 (ASZ1), transcript variant 1 |
CNY 4,840.00 |
|
TP319070 | Recombinant protein of human ankyrin repeat, SAM and basic leucine zipper domain containing 1 (ASZ1), transcript variant 1, 20 µg |
CNY 2,900.00 |