Clathrin light chain (CLTA) (NM_007096) Human Mass Spec Standard
CAT#: PH319035
CLTA MS Standard C13 and N15-labeled recombinant protein (NP_009027)
View other "Clathrin light chain" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CLTA MS Standard C13 and N15-labeled recombinant protein (NP_009027) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219035 |
Predicted MW | 26.9 kDa |
Protein Sequence |
>RC219035 representing NM_007096
Red=Cloning site Green=Tags(s) MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPG GPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAI KELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTE WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009027 |
RefSeq Size | 1105 |
RefSeq ORF | 744 |
Synonyms | LCA |
Locus ID | 1211 |
Cytogenetics | 9p13.3 |
Summary | Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, May 2010] |
Protein Pathways | Endocytosis, Huntington's disease, Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400696 | CLTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416209 | CLTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400696 | Transient overexpression lysate of clathrin, light chain (Lca) (CLTA), transcript variant 1 |
CNY 3,080.00 |
|
LY416209 | Transient overexpression lysate of clathrin, light chain (Lca) (CLTA), transcript variant 2 |
CNY 3,080.00 |
|
TP319035 | Recombinant protein of human clathrin, light chain (Lca) (CLTA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760082 | Recombinant protein of human clathrin, light chain (Lca) (CLTA), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Clathrin light chain产品