ACSL5 (NM_203380) Human Mass Spec Standard
CAT#: PH318932
ACSL5 MS Standard C13 and N15-labeled recombinant protein (NP_976314)
View other "ACSL5" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | ACSL5 MS Standard C13 and N15-labeled recombinant protein (NP_976314) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218932 |
Predicted MW | 82.3 kDa |
Protein Sequence |
>RC218932 protein sequence
Red=Cloning site Green=Tags(s) MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKMLFIFNFLFSPLPT PALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRG LAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYT YSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGE KSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYE PTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQN EAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAA MGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGY LKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVH GESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLH PEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_976314 |
RefSeq Size | 3399 |
RefSeq ORF | 2220 |
Synonyms | ACS2; ACS5; FACL5 |
Locus ID | 51703 |
Cytogenetics | 10q25.2 |
Summary | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404321 | ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC404322 | ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC414108 | ACSL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404321 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 2 |
CNY 4,840.00 |
|
LY404322 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 3 |
CNY 4,840.00 |
|
LY414108 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 1 |
CNY 3,080.00 |
|
PH313380 | ACSL5 MS Standard C13 and N15-labeled recombinant protein (NP_976313) |
CNY 19,520.00 |
|
TP313380 | Recombinant protein of human acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP318932 | Recombinant protein of human acyl-CoA synthetase long-chain family member 5 (ACSL5), transcript variant 3, 20 µg |
CNY 2,900.00 |