Syntenin 2 (SDCBP2) (NM_015685) Human Mass Spec Standard
CAT#: PH318898
SDCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_056500)
View other "Syntenin 2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SDCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_056500) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218898 |
Predicted MW | 22.5 kDa |
Protein Sequence |
>RC218898 representing NM_015685
Red=Cloning site Green=Tags(s) MVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQI DGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNG LLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056500 |
RefSeq Size | 1274 |
RefSeq ORF | 621 |
Synonyms | SITAC; SITAC18; ST-2; ST2 |
Locus ID | 27111 |
Cytogenetics | 20p13 |
Summary | The protein encoded by this gene contains two class II PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins, and PDZ-containing proteins mediate cell signaling and the organization of protein complexes. The encoded protein binds to phosphatidylinositol 4, 5-bisphosphate (PIP2) and plays a role in nuclear PIP2 organization and cell division. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Read-through transcription also exists between this gene and the upstream FKBP1A (FK506 binding protein 1A, 12kDa) gene, as represented in GeneID:100528031. [provided by RefSeq, Sep 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409179 | SDCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414380 | SDCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409179 | Transient overexpression lysate of syndecan binding protein (syntenin) 2 (SDCBP2), transcript variant 1 |
CNY 3,080.00 |
|
LY414380 | Transient overexpression lysate of syndecan binding protein (syntenin) 2 (SDCBP2), transcript variant 2 |
CNY 3,080.00 |
|
TP318898 | Recombinant protein of human syndecan binding protein (syntenin) 2 (SDCBP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Syntenin 2产品