Sterol carrier protein 2 (SCP2) (NM_001007100) Human Mass Spec Standard
CAT#: PH318251
SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_001007101)
View other "Sterol carrier protein 2" proteins (15)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_001007101) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218251 |
Predicted MW | 15.08 kDa |
Protein Sequence |
>RC218251 representing NM_001007100
Red=Cloning site Green=Tags(s) MGFPEAARTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVD VKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001007101 |
RefSeq Size | 1438 |
RefSeq ORF | 420 |
Synonyms | NLTP; NSL-TP; SCOX; SCP-2; SCP-CHI; SCP-X; SCPX |
Locus ID | 6342 |
Cytogenetics | 1p32.3 |
Summary | This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.[provided by RefSeq, Aug 2010] |
Protein Pathways | Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401042 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC422797 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC422798 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC434253 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC434278 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC434294 | SCP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401042 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 1 |
CN¥ 4,840.00 |
|
LY422797 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 3 |
CN¥ 3,080.00 |
|
LY422798 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 4 |
CN¥ 3,080.00 |
|
LY434253 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 8 |
CN¥ 3,080.00 |
|
LY434278 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 6 |
CN¥ 3,080.00 |
|
LY434294 | Transient overexpression lysate of sterol carrier protein 2 (SCP2), transcript variant 7 |
CN¥ 3,080.00 |
|
PH319802 | SCP2 MS Standard C13 and N15-labeled recombinant protein (NP_002970) |
CN¥ 19,520.00 |
|
TP318251 | Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
|
TP319802 | Recombinant protein of human sterol carrier protein 2 (SCP2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
其它Sterol carrier protein 2产品