Estrogen Related Receptor gamma (ESRRG) (NM_001438) Human Mass Spec Standard
CAT#: PH318233
ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001429)
View other "Estrogen Related Receptor gamma" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001429) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218233 |
Predicted MW | 51.1 kDa |
Protein Sequence |
>RC218233 representing NM_001438
Red=Cloning site Green=Tags(s) MDSVELCLPESFSLHYEEELPCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSS TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHY GVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKY KRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVII GWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAIL QLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001429 |
RefSeq Size | 5253 |
RefSeq ORF | 1374 |
Synonyms | ERR-gamma; ERR3; ERRg; ERRgamma; NR3B3 |
Locus ID | 2104 |
Cytogenetics | 1q41 |
Summary | This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5' end and some of which encode protein isoforms differing in the N-terminal region. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400557 | ESRRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC404215 | ESRRG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400557 | Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 1 |
CNY 4,840.00 |
|
LY404215 | Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 2 |
CNY 4,840.00 |
|
PH312143 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996317) |
CNY 19,520.00 |
|
PH314462 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996318) |
CNY 14,250.00 |
|
PH325714 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001127757) |
CNY 14,250.00 |
|
TP312143 | Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP314462 | Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP318233 | Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325714 | Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP762660 | Purified recombinant protein of Human estrogen-related receptor gamma (ESRRG), transcript variant 1, full length, with N-GST and C-His tag, expressed in E.coli, 50ug |
CNY 2,480.00 |
其它Estrogen Related Receptor gamma产品