Tapasin (TAPBP) (NM_003190) Human Mass Spec Standard
CAT#: PH317968
TAPBP MS Standard C13 and N15-labeled recombinant protein (NP_003181)
View other "Tapasin" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TAPBP MS Standard C13 and N15-labeled recombinant protein (NP_003181) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217968 |
Predicted MW | 47.63 kDa |
Protein Sequence |
>RC217968 representing NM_003190
Red=Cloning site Green=Tags(s) MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHD PAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALDGAWLMVSISSPVLSLSSLLR PQPEPQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDLSFAYMPPTSEAASSLAPGPPPFGLEWRRQH LGKGHLLLAATPGLNGQMPAAQEGAVAFAAWDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQG QVTLELAVYKPPKVSLMPATLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLS ALRHHSDGSVSLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSA FLLLGLFKALGWAAVYLSTCKDSKKKAE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003181 |
RefSeq Size | 3629 |
RefSeq ORF | 1344 |
Synonyms | NGS17; TAPA; TPN; TPSN |
Locus ID | 6892 |
Cytogenetics | 6p21.32 |
Summary | This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406739 | TAPBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406740 | TAPBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418843 | TAPBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY406739 | Transient overexpression lysate of TAP binding protein (tapasin) (TAPBP), transcript variant 2 |
CNY 3,080.00 |
|
LY406740 | Transient overexpression lysate of TAP binding protein (tapasin) (TAPBP), transcript variant 3 |
CNY 3,080.00 |
|
LY418843 | Transient overexpression lysate of TAP binding protein (tapasin) (TAPBP), transcript variant 1 |
CNY 4,840.00 |
|
TP317968 | Recombinant protein of human TAP binding protein (tapasin) (TAPBP), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Tapasin产品