Myosin Phosphatase 2 (PPP1R12B) (NM_032104) Human Mass Spec Standard
CAT#: PH317905
PPP1R12B MS Standard C13 and N15-labeled recombinant protein (NP_115287)
View other "Myosin Phosphatase 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PPP1R12B MS Standard C13 and N15-labeled recombinant protein (NP_115287) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217905 |
Predicted MW | 26.1 kDa |
Protein Sequence |
>RC217905 representing NM_032104
Red=Cloning site Green=Tags(s) MDKNENEEADLDEQSSKRLSIRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESGGSNP TTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKLQEAQLELADIKSKL EKVAQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKNLHQLKQIQTLKQMNEQLQAENRALTRVVA RLSESIESSDTQEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115287 |
RefSeq Size | 2227 |
RefSeq ORF | 672 |
Synonyms | MYPT2; PP1bp55 |
Locus ID | 4660 |
Cytogenetics | 1q32.1 |
Summary | Myosin phosphatase is a protein complex comprised of three subunits: a catalytic subunit (PP1c-delta, protein phosphatase 1, catalytic subunit delta), a large regulatory subunit (MYPT, myosin phosphatase target) and small regulatory subunit (sm-M20). Two isoforms of MYPT have been isolated--MYPT1 and MYPT2, the first of which is widely expressed, and the second of which may be specific to heart, skeletal muscle, and brain. Each of the MYPT isoforms functions to bind PP1c-delta and increase phosphatase activity. This locus encodes both MYTP2 and M20. Alternatively spliced transcript variants encoding different isoforms have been identified. Related pseudogenes have been defined on the Y chromosome. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410386 | PPP1R12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410386 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 12B (PPP1R12B), transcript variant 4 |
CNY 3,080.00 |
|
TP317905 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 12B (PPP1R12B), transcript variant 4, 20 µg |
CNY 2,900.00 |
其它Myosin Phosphatase 2产品