United States
Germany
Japan
United Kingdom
China
ING1 (NM_198219) Human Mass Spec Standard
CAT＃: PH317763
ING1 MS Standard C13 and N15-labeled recombinant protein (NP_937862)
View other "ING1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ING1 MS Standard C13 and N15-labeled recombinant protein (NP_937862) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217763 |
| Predicted MW | 31.9 kDa |
| Protein Sequence |
>RC217763 protein sequence
Red=Cloning site Green=Tags(s) MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRM LHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA QADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEP TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_937862 |
| RefSeq Size | 2887 |
| RefSeq ORF | 837 |
| Synonyms | p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a |
| Locus ID | 3621 |
| Cytogenetics | 13q34 |
| Summary | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403677 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404951 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417242 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC429254 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430724 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403677 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 2 |
CNY 3,080.00 |
|
| LY404951 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 |
CNY 3,080.00 |
|
| LY417242 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 4 |
CNY 4,840.00 |
|
| LY430724 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 |
CNY 3,080.00 |
|
| TP317763 | Recombinant protein of human inhibitor of growth family, member 1 (ING1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP760507 | Purified recombinant protein of Human inhibitor of growth family, member 1 (ING1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
