ING1 (NM_198219) Human Mass Spec Standard
CAT#: PH317763
ING1 MS Standard C13 and N15-labeled recombinant protein (NP_937862)
View other "ING1" proteins (11)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ING1 MS Standard C13 and N15-labeled recombinant protein (NP_937862) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217763 |
Predicted MW | 31.9 kDa |
Protein Sequence |
>RC217763 protein sequence
Red=Cloning site Green=Tags(s) MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRM LHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA QADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEP TYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_937862 |
RefSeq Size | 2887 |
RefSeq ORF | 837 |
Synonyms | p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a |
Locus ID | 3621 |
Cytogenetics | 13q34 |
Summary | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403677 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404951 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC417242 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC429254 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC430724 | ING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403677 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY404951 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY417242 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 4 |
CN¥ 4,840.00 |
|
LY430724 | Transient overexpression lysate of inhibitor of growth family, member 1 (ING1), transcript variant 1 |
CN¥ 3,080.00 |
|
TP317763 | Recombinant protein of human inhibitor of growth family, member 1 (ING1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP760507 | Purified recombinant protein of Human inhibitor of growth family, member 1 (ING1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |