CYB5R3 (NM_007326) Human Mass Spec Standard
CAT#: PH317552
CYB5R3 MS Standard C13 and N15-labeled recombinant protein (NP_015565)
View other "CYB5R3" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CYB5R3 MS Standard C13 and N15-labeled recombinant protein (NP_015565) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217552 |
Predicted MW | 31.4 kDa |
Protein Sequence |
>RC217552 representing NM_007326
Red=Cloning site Green=Tags(s) MKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRP YTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDK KSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARF KLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_015565 |
RefSeq Size | 2000 |
RefSeq ORF | 834 |
Synonyms | B5R; DIA1 |
Locus ID | 1727 |
Cytogenetics | 22q13.2 |
Summary | This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. [provided by RefSeq, Jan 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400140 | CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416053 | CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432902 | CYB5R3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400140 | Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 1 |
CNY 3,080.00 |
|
LY416053 | Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 2 |
CNY 3,080.00 |
|
LY432902 | Transient overexpression lysate of cytochrome b5 reductase 3 (CYB5R3), transcript variant 5 |
CNY 3,080.00 |
|
PH301592 | CYB5R3 MS Standard C13 and N15-labeled recombinant protein (NP_000389) |
CNY 19,520.00 |
|
TP301592 | Recombinant protein of human cytochrome b5 reductase 3 (CYB5R3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317552 | Recombinant protein of human cytochrome b5 reductase 3 (CYB5R3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP329902 | Purified recombinant protein of Homo sapiens cytochrome b5 reductase 3 (CYB5R3), transcript variant 5, 20 µg |
CNY 2,900.00 |