CDYL (NM_170752) Human Mass Spec Standard
CAT#: PH317438
CDYL MS Standard C13 and N15-labeled recombinant protein (NP_736608)
View other "CDYL" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CDYL MS Standard C13 and N15-labeled recombinant protein (NP_736608) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217438 |
Predicted MW | 34.4 kDa |
Protein Sequence |
>RC217438 representing NM_170752
Red=Cloning site Green=Tags(s) MDALTANGTTNIQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLST KSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRESTKMAEAIRN FVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASA NEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMELEQANER ECEVLKKIWGSAQGTDSMLKYMQRKIDEF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_736608 |
RefSeq Size | 2805 |
RefSeq ORF | 927 |
Synonyms | CDYL1, MGC131936, DKFZp586C1622 |
Locus ID | 9425 |
Cytogenetics | 6p25.1 |
Summary | Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406868 | CDYL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406869 | CDYL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406868 | Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 2 |
CNY 3,080.00 |
|
LY406869 | Transient overexpression lysate of chromodomain protein, Y-like (CDYL), transcript variant 3 |
CNY 3,080.00 |
|
TP317438 | Recombinant protein of human chromodomain protein, Y-like (CDYL), transcript variant 3, 20 µg |
CNY 2,900.00 |