Glycophorin C (GYPC) (NM_016815) Human Mass Spec Standard
CAT#: PH317103
GYPC MS Standard C13 and N15-labeled recombinant protein (NP_058131)
View other "Glycophorin C" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GYPC MS Standard C13 and N15-labeled recombinant protein (NP_058131) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217103 |
Predicted MW | 11.7 kDa |
Protein Sequence |
>RC217103 representing NM_016815
Red=Cloning site Green=Tags(s) MWSTRSPNSTAWPLSLEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKG TYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_058131 |
RefSeq Size | 1019 |
RefSeq ORF | 327 |
Synonyms | CD236; CD236R; GE; GE:GPC:GPD:GYPD; GPC; GPD; GYPD; PAS-2; PAS-2' |
Locus ID | 2995 |
Cytogenetics | 2q14.3 |
Summary | Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413831 | GYPC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419537 | GYPC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413831 | Transient overexpression lysate of glycophorin C (Gerbich blood group) (GYPC), transcript variant 2 |
CNY 3,080.00 |
|
LY419537 | Transient overexpression lysate of glycophorin C (Gerbich blood group) (GYPC), transcript variant 1 |
CNY 3,080.00 |
|
TP317103 | Recombinant protein of human glycophorin C (Gerbich blood group) (GYPC), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Glycophorin C产品