Glycophorin C (GYPC) (NM_016815) Human Tagged ORF Clone
CAT#: RC217103
GYPC (Myc-DDK-tagged)-Human glycophorin C (Gerbich blood group) (GYPC), transcript variant 2
ORF Plasmid: tGFP
"NM_016815" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CD236; CD236R; GE; GE:GPC:GPD:GYPD; GPC; GPD; GYPD; PAS-2; PAS-2' |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC217103 representing NM_016815
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGGTCGACGAGAAGCCCCAACAGCACGGCGTGGCCTCTCAGCCTCGAGCCTGATCCAGGGATGTCTG GATGGCCGGATGGCAGAATGGAGACCTCCACCCCCACCATAATGGACATTGTCGTCATTGCAGGTGTGAT TGCTGCTGTGGCCATCGTCCTAGTCTCCCTCCTCTTCGTCATGCTGCGCTACATGTACCGGCACAAGGGC ACGTACCACACCAATGAGGCCAAGGGCACGGAGTTTGCTGAGAGTGCAGATGCAGCCCTGCAGGGAGACC CTGCCCTCCAAGATGCTGGTGATAGCAGCAGAAAGGAGTACTTTATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC217103 representing NM_016815
Red=Cloning site Green=Tags(s) MWSTRSPNSTAWPLSLEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKG TYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_016815 |
ORF Size | 327 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_016815.3 |
RefSeq Size | 1019 bp |
RefSeq ORF | 330 bp |
Locus ID | 2995 |
UniProt ID | P04921 |
Protein Families | Druggable Genome, Transmembrane |
MW | 11.7 kDa |
Gene Summary | Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC217103L1 | Lenti ORF clone of Human glycophorin C (Gerbich blood group) (GYPC), transcript variant 2, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC217103L2 | Lenti ORF clone of Human glycophorin C (Gerbich blood group) (GYPC), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC217103L3 | Lenti ORF clone of Human glycophorin C (Gerbich blood group) (GYPC), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC217103L4 | Lenti ORF clone of Human glycophorin C (Gerbich blood group) (GYPC), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG217103 | GYPC (tGFP-tagged) - Human glycophorin C (Gerbich blood group) (GYPC), transcript variant 2 |
CNY 4,370.00 |
|
SC114128 | GYPC (untagged)-Human glycophorin C (Gerbich blood group) (GYPC), transcript variant 2 |
CNY 3,990.00 |
其它Glycophorin C产品