p15 INK4b (CDKN2B) (NM_078487) Human Mass Spec Standard

Specifications

Product Data
Description	CDKN2B MS Standard C13 and N15-labeled recombinant protein (NP_511042)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC217024
Predicted MW	7.9 kDa
Protein Sequence	Sequence Link (showhide) >RC217024 representing NM_078487 Red=Cloning site Green=Tags(s) MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVAGAPGPRRQGARERGAR PRRIGAGT SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_511042
RefSeq Size	4001
RefSeq ORF	234
Synonyms	CDK4I; INK4B; MTS2; P15; p15INK4b; TP15
Locus ID	1030
Cytogenetics	9p21.3
Summary	This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]
Protein Families	Druggable Genome
Protein Pathways	Cell cycle, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.