MNK2 (MKNK2) (NM_199054) Human Mass Spec Standard
CAT#: PH316704
MKNK2 MS Standard C13 and N15-labeled recombinant protein (NP_951009)
View other "MNK2" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MKNK2 MS Standard C13 and N15-labeled recombinant protein (NP_951009) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216704 |
Predicted MW | 51.7 kDa |
Protein Sequence |
>RC216704 representing NM_199054
Red=Cloning site Green=Tags(s) MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGR ATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHR NVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPEN ILCEHPNQVSPVKICDFDLGSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWS LGVILYILLSGYPPFVGRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLV RDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAG QGQPVLVRATSRCLQLSPPSQSKLAQRRQRASLSSAPVVLVGDHA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_951009 |
RefSeq Size | 3795 |
RefSeq ORF | 1395 |
Synonyms | GPRK7; MNK2 |
Locus ID | 2872 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes a member of the calcium/calmodulin-dependent protein kinases (CAMK) Ser/Thr protein kinase family, which belongs to the protein kinase superfamily. This protein contains conserved DLG (asp-leu-gly) and ENIL (glu-asn-ile-leu) motifs, and an N-terminal polybasic region which binds importin A and the translation factor scaffold protein eukaryotic initiation factor 4G (eIF4G). This protein is one of the downstream kinases activated by mitogen-activated protein (MAP) kinases. It phosphorylates the eukaryotic initiation factor 4E (eIF4E), thus playing important roles in the initiation of mRNA translation, oncogenic transformation and malignant cell proliferation. In addition to eIF4E, this protein also interacts with von Hippel-Lindau tumor suppressor (VHL), ring-box 1 (Rbx1) and Cullin2 (Cul2), which are all components of the CBC(VHL) ubiquitin ligase E3 complex. Multiple alternatively spliced transcript variants have been found, but the full-length nature and biological activity of only two variants are determined. These two variants encode distinct isoforms which differ in activity and regulation, and in subcellular localization. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Insulin signaling pathway, MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404728 | MKNK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC413712 | MKNK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404728 | Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2 |
CNY 4,840.00 |
|
LY413712 | Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1 |
CNY 3,080.00 |
|
TP316704 | Recombinant protein of human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760279 | Recombinant protein of human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |