United States
Germany
Japan
United Kingdom
China
CD98 (SLC3A2) (NM_001012664) Human Mass Spec Standard
CAT＃: PH316693
SLC3A2 MS Standard C13 and N15-labeled recombinant protein (NP_001012682)
View other "CD98" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | SLC3A2 MS Standard C13 and N15-labeled recombinant protein (NP_001012682) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216693 |
| Predicted MW | 61.8 kDa |
| Protein Sequence |
>RC216693 protein sequence
Red=Cloning site Green=Tags(s) MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSGTMSQDTEVDMKEVELNELEPEKQPMNAASGAA MSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVV IIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDV AQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGV DGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTG EHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQ PMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFS YIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGL LLRFPYAA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001012682 |
| RefSeq Size | 2161 |
| RefSeq ORF | 1704 |
| Synonyms | 4F2; 4F2HC; 4T2HC; CD98; CD98HC; MDU1; NACAE |
| Locus ID | 6520 |
| Cytogenetics | 11q12.3 |
| Summary | This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized. [provided by RefSeq, Nov 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400390 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419347 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422810 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC429102 | SLC3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400390 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 2 |
CNY 3,080.00 |
|
| LY419347 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 3 |
CNY 3,080.00 |
|
| LY422810 | Transient overexpression lysate of solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 5 |
CNY 4,840.00 |
|
| PH316640 | SLC3A2 MS Standard C13 and N15-labeled recombinant protein (NP_002385) |
CNY 19,520.00 |
|
| TP316640 | Recombinant protein of human solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP316693 | Recombinant protein of human solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP720445 | Recombinant protein of human solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 (SLC3A2), transcript variant 2 |
CNY 1,800.00 |
