PYCR1 (NM_153824) Human Mass Spec Standard
CAT#: PH316359
PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546)
View other "PYCR1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_722546) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216359 |
Predicted MW | 33.2 kDa |
Protein Sequence |
>RC216359 representing NM_153824
Red=Cloning site Green=Tags(s) MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAV KPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTH AQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQAL LGAAKMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA AIKKTILDKDHLPLELGSPEGLHPLLLQYQLARAPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_722546 |
RefSeq Size | 1768 |
RefSeq ORF | 948 |
Synonyms | ARCL2B; ARCL3B; P5C; P5CR; PIG45; PP222; PRO3; PYCR |
Locus ID | 5831 |
Cytogenetics | 17q25.3 |
Summary | This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes to the mitochondrion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406968 | PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416328 | PYCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406968 | Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2 |
CNY 3,080.00 |
|
LY416328 | Transient overexpression lysate of pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1 |
CNY 3,080.00 |
|
PH310027 | PYCR1 MS Standard C13 and N15-labeled recombinant protein (NP_008838) |
CNY 19,520.00 |
|
TP310027 | Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP316359 | Recombinant protein of human pyrroline-5-carboxylate reductase 1 (PYCR1), transcript variant 2, 20 µg |
CNY 2,900.00 |