DEFB121 (NM_001011878) Human Mass Spec Standard
CAT#: PH316173
DEFB121 MS Standard C13 and N15-labeled recombinant protein (NP_001011878)
View other "DEFB121" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | DEFB121 MS Standard C13 and N15-labeled recombinant protein (NP_001011878) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216173 |
Predicted MW | 8.5 kDa |
Protein Sequence |
>RC216173 protein sequence
Red=Cloning site Green=Tags(s) MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSL ESTSAV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001011878 |
RefSeq Size | 418 |
RefSeq ORF | 228 |
Synonyms | DEFB21; ESC42RELC |
Locus ID | 245934 |
Cytogenetics | 20q11.21 |
Summary | This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423307 | DEFB121 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423307 | Transient overexpression lysate of defensin, beta 121 (DEFB121), transcript variant 1 |
CNY 3,080.00 |
|
TP316173 | Recombinant protein of human defensin, beta 121 (DEFB121), 20 µg |
CNY 2,900.00 |
其它DEFB121产品